SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q9EQV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q9EQV6
Domain Number 1 Region: 10-55
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000366
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0074
Further Details:      
 
Weak hits

Sequence:  A0A1Q9EQV6
Domain Number - Region: 51-107
Classification Level Classification E-value
Superfamily EF-hand 0.000146
Family Parvalbumin 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Q9EQV6
Sequence length 139
Comment (tr|A0A1Q9EQV6|A0A1Q9EQV6_SYMMI) Uncharacterized protein {ECO:0000313|EMBL:OLQ09802.1} KW=Complete proteome; Reference proteome OX=2951 OS=microadriatica). GN=AK812_SmicGene6548 OC=Symbiodinium.
Sequence
MEDDSHYVNLQQAREYLEKNSIPKLLESLLARAVLERPPDLRNFLIESLRDLKAQRESPS
MELFTVEDIETMFDMWDYDKVGMIAASKVMETLKALNCSDLSEEELRSRPWSQLSEVDKT
SFVKYVRHELETRTAKMLK
Download sequence
Identical sequences A0A1Q9EQV6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]