SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q9HY26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q9HY26
Domain Number 1 Region: 7-270
Classification Level Classification E-value
Superfamily Hypothetical protein YwqG 2.48e-87
Family Hypothetical protein YwqG 0.000000623
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Q9HY26
Sequence length 271
Comment (tr|A0A1Q9HY26|A0A1Q9HY26_BACCE) Cytoplasmic protein {ECO:0000313|EMBL:OLR22587.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=BLD50_27450 OC=Bacillus cereus group.
Sequence
MKNTYQLQIPKELEQYRSILEESVKPYVKVSGTRAETTLFESKFGGYPYLPIDQDHPKDS
NGQPMMLLAQLNLEEIPNIEHMPQHGMLQFFISAEEDLFGADFDHPTVQKDFRIIYHSTI
IEDLNKVITDFSYLNTLELEDFIIPEAAKLKFELGYQPVTSRDYRFEKMFSEDIDWEEIV
DEENNTELGELYDDLCKDQGHKIGGYPFFTQTDPREWEEKYQQHDILLLQIDTDDSLNIM
WGDSGVANFFIRKEELLNLDFSNVIYNWDCY
Download sequence
Identical sequences A0A1C9BUC5 A0A1Q9HY26 A0A243EUR5
WP_069355687.1.41090 WP_069355687.1.54547 WP_069355687.1.70108 WP_069355687.1.75891 WP_069355687.1.93838 WP_069355687.1.9533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]