SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q9PQ88 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1Q9PQ88
Domain Number - Region: 52-170
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00262
Family Pseudo ankyrin repeat 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Q9PQ88
Sequence length 202
Comment (tr|A0A1Q9PQ88|A0A1Q9PQ88_BACPF) Uncharacterized protein {ECO:0000313|EMBL:OLS36539.1} KW=Complete proteome OX=79885 OS=Bacillus pseudofirmus. GN=BTR22_10905 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MSRKWLVLSIMTAVIASCGVSYFYMFHQPNIETTAHAEARMIPSDHPDPEMMQEEADFLV
TLQYGEYEEEIAYQDGQEKKVKAIISAQHSYLNTLAGWGRAEDLNVAATMYTKEWKKLRA
DIKWLHDEGLADSRIKNDMKNARAFMYVAETGDSMSLRYLHRIFHDLDATLNGAEVEKVW
EVTHAFGTSSKQRTLHKYLQGN
Download sequence
Identical sequences A0A1Q9PQ88 D3FW23
gi|288555412|ref|YP_003427347.1| WP_012957819.1.66041 WP_012957819.1.97837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]