SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1R0X9H0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1R0X9H0
Domain Number 1 Region: 4-54
Classification Level Classification E-value
Superfamily BAS1536-like 0.00000000824
Family BAS1536-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1R0X9H0
Sequence length 57
Comment (tr|A0A1R0X9H0|A0A1R0X9H0_9BACL) Uncharacterized protein {ECO:0000313|EMBL:OMD31461.1} KW=Complete proteome OX=189426 OS=Paenibacillus odorifer. GN=BSO21_17320 OC=Paenibacillus.
Sequence
MNDQEIIQKRIEGARNKLYLMERQHGGLSHPNVIRQSMRLDELINQYNKAVHSDNEN
Download sequence
Identical sequences A0A1R0X9H0
WP_076129534.1.11368 WP_076129534.1.12451 WP_076129534.1.21042 WP_076129534.1.4035 WP_076129534.1.44012 WP_076129534.1.45277 WP_076129534.1.52821 WP_076129534.1.65322 WP_076129534.1.68757 WP_076129534.1.70734 WP_076129534.1.8272 WP_076129534.1.86446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]