SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1R0XBZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1R0XBZ5
Domain Number 1 Region: 119-186
Classification Level Classification E-value
Superfamily TrpR-like 1.62e-17
Family SPO1678-like 0.021
Further Details:      
 
Domain Number 2 Region: 59-106
Classification Level Classification E-value
Superfamily TrpR-like 0.00000000837
Family SPO1678-like 0.064
Further Details:      
 
Domain Number 3 Region: 2-59
Classification Level Classification E-value
Superfamily TrpR-like 0.00000000994
Family SPO1678-like 0.028
Further Details:      
 
Weak hits

Sequence:  A0A1R0XBZ5
Domain Number - Region: 191-222
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.00301
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1R0XBZ5
Sequence length 229
Comment (tr|A0A1R0XBZ5|A0A1R0XBZ5_9BACL) Transposase {ECO:0000313|EMBL:OMD32570.1} KW=Complete proteome OX=189426 OS=Paenibacillus odorifer. GN=BJP51_15835 OC=Paenibacillus.
Sequence
MSNRSPTSLKVKLHVVGLCLEHKSNPNYEAKQLGLSSHTVREWIRKYKADGLDGLRESRT
WKSYPKELKLAAVNEVLSGRCSVEEVTNKHYISSRSVLTKWITKYTNEIELKPTHTGKGL
SHMNQGRKTTFEERIEIAQYTIANGLDYQKAIEKYGVSYQQVYAWVRKYQVGREEALQDN
RGRKKPVEELDEHDRLKLRIKELEARNEYLEMENDFAKKLAEIKRRNTR
Download sequence
Identical sequences A0A1R0XBZ5
WP_036683516.1.11174 WP_036683516.1.52880 WP_036683516.1.80404 WP_036683516.1.83223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]