SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1R1PQQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1R1PQQ6
Domain Number 1 Region: 193-425
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.59e-24
Family Ankyrin repeat 0.00075
Further Details:      
 
Domain Number 2 Region: 21-100,216-246
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000000235
Family Pseudo ankyrin repeat 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1R1PQQ6
Sequence length 450
Comment (tr|A0A1R1PQQ6|A0A1R1PQQ6_ZANCU) Putative ankyrin repeat protein L63 {ECO:0000313|EMBL:OMH83202.1} KW=Complete proteome; Reference proteome OX=1213189 OS=Zancudomyces culisetae (Gut fungus) (Smittium culisetae). GN=AX774_g3295 OC=Legeriomycetaceae; Zancudomyces.
Sequence
IGWIDYFISKGAKFNEESDGFDEACKSDKVEVLEHWIKNGGVVPNNPEYLCINMACLLGN
FKMVKLLVENGVDLSDPKTNGVRIACRLGFTKTLKYLLDNNAVLGRICRYQLEYACLTED
IGLVKIILGYYDNLGVLEKRETSNTKEDEEPQNDSLLDNENSGHSEKYKITNTLLETGEP
IQNSDLVDGIKASASVANIEILKLLLTYKINYNGNYNDNFEIDEAAVQTGNVDVVKTFLD
NGISVDGDEVTLDIAFREKNTEMIKLLLRHGAKVKSDSNNLCLYFGVIDTETLLLMLTCC
TELKDDQHLLEFAVCKNNLEAVKLLLKDTISLKDSKYNFVFYACENNNLEILKFLFEKGA
KIEKGRLSGVSQACKNNNLEMLKLLLERNPNLVLNVDYGLKEAIDHKNMDMIKLLIMYGA
DISTHRKSIMEVASNLNNDCLTEFCQNRAA
Download sequence
Identical sequences A0A1R1PQQ6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]