SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1R1RLC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1R1RLC9
Domain Number - Region: 194-248
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00517
Family Rad21/Rec8-like 0.028
Further Details:      
 
Domain Number - Region: 97-163
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 0.0745
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1R1RLC9
Sequence length 251
Comment (tr|A0A1R1RLC9|A0A1R1RLC9_9BACI) Segregation and condensation protein A {ECO:0000256|HAMAP-Rule:MF_01805, ECO:0000256|SAAS:SAAS00952062} KW=Complete proteome OX=1925021 OS=Bacillus haynesii. GN=BTA31_14550 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MEYQVKIEAFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRELELDVASEYLV
MAATLLSIKSRMLLPKQEEELFDEELLEEEEDPREELIEKLIEYRKYKSAAQNLKEREEE
RQKAFAKPPSDLSDYAKEIKLSEQKLSVTVYDMLGAFQKVLNRKKINRPSETRISRQEIP
IEERMTQIVDCLKTSRKRMHFMELFPYEQKEHLVVTFLAILELMKNQLIIIEQEHNFSDI
YITGSEAIHDA
Download sequence
Identical sequences A0A1R1RLC9 W7R4W6
WP_043928425.1.3958 WP_043928425.1.62231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]