SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1R1YSI3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1R1YSI3
Domain Number 1 Region: 3-108
Classification Level Classification E-value
Superfamily MAL13P1.257-like 8.11e-35
Family MAL13P1.257-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1R1YSI3
Sequence length 111
Comment (tr|A0A1R1YSI3|A0A1R1YSI3_9FUNG) UPF0587 protein {ECO:0000313|EMBL:OMJ29852.1} KW=Complete proteome OX=133412 OS=Smittium culicis. GN=AYI69_g631 OC=Legeriomycetaceae; Smittium.
Sequence
MVDEIEIPGSRGSANYVSRCKFCKREGVASIVAGPNKYSNDANAFQTILVLDCRGIEPVE
FDFRRNWEAVGPESNSKFAEIDLSENEFFDYDEKGGNEVSIVDLEYKFVRA
Download sequence
Identical sequences A0A1R1YSI3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]