SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1R2AQC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1R2AQC0
Domain Number 1 Region: 678-915
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.35e-53
Family DnaQ-like 3'-5' exonuclease 0.0000309
Further Details:      
 
Domain Number 2 Region: 191-474
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.19e-49
Family Ankyrin repeat 0.00023
Further Details:      
 
Domain Number 3 Region: 552-670
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000105
Family Pseudo ankyrin repeat 0.031
Further Details:      
 
Domain Number 4 Region: 32-94
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000213
Family Glutathione S-transferase (GST), C-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1R2AQC0
Sequence length 926
Comment (tr|A0A1R2AQC0|A0A1R2AQC0_9CILI) Uncharacterized protein {ECO:0000313|EMBL:OMJ66679.1} KW=Complete proteome; Reference proteome OX=5963 OS=Stentor coeruleus. GN=SteCoe_36399 OC=Heterotrichea; Heterotrichida; Stentoridae; Stentor.
Sequence
MEWFTAVKSNHFKNQSPSGFWAKVADSIDPSNPTIHYTIINDHLQNKTFLQGHQLTIEDL
YLASKLMQCPAWCKVLPCKTRPFHLTRWFMYIISAFPNINYKIHEKAKKIIKKDHRLVTA
IKQENMELFINLLDKVDINAQSPSDGGARPXNINYKIHEKAKKIIKKDHRLVTAIKQENM
ELFINLLDKVDINAQSPSDGGARPLHAAAQKGNIQAIEILLQKGAHIEGQDEDGVTPIIY
SVQSKSVAVLNFFIEKKANIFHLDKQQRNIFYWAASLGNLQMLQILLQKGMDPNIKTLLG
RTPLSKSAWNGNAEVLSFLLEIPGINLEISDKHGRTALHNAVWGSIAGREGRKIGENTTD
SPECAKLLIEKGCNIEALDKSQNTPLCIACCTYSPNSVKLLLSYGANIYHRNIKGYYPYH
QALFKGHYECAEIIADFGFNVNICNDDLTPIQSCMKHNRIGSLNWLVSRGVYPQKNDIVL
SAQWATIKILEFFKNYMKFDGLEDLIIKKAPVEGGFWIIENTEVNEKMVIESIKKDKKLG
KAALDKWSGLVTINILEAMVEAKIDTNDYLDRAEPNSQILRLAIKQKNIKLALKLIQDYP
DLATDPDEISGNTALHIACSIGQTELVSKLINIVENRFNYITQANNKGMTSISLAQLHKH
YYIAEMLKDIVIQSQGSINLSQVQNLTYEETDETLTEHPYTDKTIPLGYWKSQSESKPLS
DTKYVYIDTDQGIEDLINDIGNFSVIGVDLEYHAFESNKGCICLLQISNGEVDYVIDGLL
CREKLKILVKRFMDDEKIVKVFHGCDSDLVWLKNDFDAHPVRVFDTARAYKVLNNEKQLP
SLAKIVQEYFDVVMDKTFQIAEWRIRPLPAAMIEYARIDAHFLLSIFNKQLIEMNEIQLQ
IVNAQCNHMCLKFSKNKLIKVKVSKE
Download sequence
Identical sequences A0A1R2AQC0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]