SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1R2B2U9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1R2B2U9
Domain Number 1 Region: 28-69
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000000916
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1R2B2U9
Sequence length 77
Comment (tr|A0A1R2B2U9|A0A1R2B2U9_9CILI) Uncharacterized protein {ECO:0000313|EMBL:OMJ71108.1} KW=Complete proteome; Reference proteome OX=5963 OS=Stentor coeruleus. GN=SteCoe_30758 OC=Heterotrichea; Heterotrichida; Stentoridae; Stentor.
Sequence
MMFLDKNNSLRLYNNMADIKEMRIFAAEQISVPEELPGILKNYAKEVIKNNPKDIITFSA
NYFEKLYEETSKHHPHK
Download sequence
Identical sequences A0A1R2B2U9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]