SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1R2C3V3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1R2C3V3
Domain Number 1 Region: 246-372,403-451
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.73e-28
Family Nucleotide and nucleoside kinases 0.00048
Further Details:      
 
Domain Number 2 Region: 56-201
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000154
Family Nucleotide and nucleoside kinases 0.0047
Further Details:      
 
Domain Number 3 Region: 11-50
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000654
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1R2C3V3
Sequence length 459
Comment (tr|A0A1R2C3V3|A0A1R2C3V3_9CILI) Uncharacterized protein {ECO:0000313|EMBL:OMJ83661.1} KW=Complete proteome; Reference proteome OX=5963 OS=Stentor coeruleus. GN=SteCoe_15389 OC=Heterotrichea; Heterotrichida; Stentoridae; Stentor.
Sequence
MDLKQKQDFQEEVEIFLDQYQIHDLFDYLLKELLIDRPDEPIDYLISKLQTKRRRRLFLI
GGIGSRRRQIARELSSRFQIEKIFLLDHLKAEVKKSGKHGSSIQKAWNTGSYIPDNIILD
IMMPHIEELEKKGSSYILEGFPRTRVQGLALQRAGVIPDRLVLMVPTESEIRAGVIERMN
ELVPVKQDNQNNIFERAIQEFSYHANGIRSAYNTQVYEISASGETSVLSSQIFRVFLAKG
RSKAPRKPPKVIILGPPGSGRSSLATALANSYGLTFVSTLQLLRDQVNRKTETGRNVSAI
INTGERVPDYIMTELVRSRLKEPDCRINGWVLDGYPKTIEQARSLREFKIIPSHVLFLEC
ADAMVYERVEQRRLDPITGVYYNVMNLPEDEGIRSRVVFMNEDHHENVKKRLANYKEHYV
KIHAEYSGHVTNIKADLDFQAVVDIARDVIESSIHPDND
Download sequence
Identical sequences A0A1R2C3V3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]