SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1R2CB82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1R2CB82
Domain Number 1 Region: 83-144
Classification Level Classification E-value
Superfamily EF-hand 0.0000306
Family Calmodulin-like 0.076
Further Details:      
 
Domain Number 2 Region: 25-68
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000366
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1R2CB82
Sequence length 153
Comment (tr|A0A1R2CB82|A0A1R2CB82_9CILI) Uncharacterized protein {ECO:0000313|EMBL:OMJ86274.1} KW=Complete proteome; Reference proteome OX=5963 OS=Stentor coeruleus. GN=SteCoe_12260 OC=Heterotrichea; Heterotrichida; Stentoridae; Stentor.
Sequence
MVRLLKKAKGKNPIETQPSANIVEKYEGYLRNHKIHELFNKLLTQILHDRPVNVRHHILE
QLSNIKNQIKNPSAHVPAYLTSGDFETMFDAYDIAGEGSLDYYTLLQAMMVAGVKNPEIY
LKQDFPQITEKSMIGKPQFTQIMNAEFTKYGFS
Download sequence
Identical sequences A0A1R2CB82

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]