SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1R2FA52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1R2FA52
Domain Number - Region: 12-46
Classification Level Classification E-value
Superfamily IpaD-like 0.00994
Family IpaD-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1R2FA52
Sequence length 51
Comment (tr|A0A1R2FA52|A0A1R2FA52_CLODI) Uncharacterized protein {ECO:0000313|EMBL:SJU08998.1} KW=Complete proteome OX=1496 OS=Clostridioides difficile (Peptoclostridium difficile). GN=SAMEA3374989_03519 OC=Peptostreptococcaceae; Clostridioides.
Sequence
MEVNLQKAYTVAFEEIKSLYNELILYKALNMQQQEEIENLKKELEEQNKEQ
Download sequence
Identical sequences A0A0A8WHY4 A0A125VBJ4 A0A1R2FA52
YP_009221627.1.93942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]