SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1R3HVQ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1R3HVQ1
Domain Number 1 Region: 78-135
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 9.29e-17
Family Skp1 dimerisation domain-like 0.00035
Further Details:      
 
Domain Number 2 Region: 8-64
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000177
Family BTB/POZ domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1R3HVQ1
Sequence length 140
Comment (tr|A0A1R3HVQ1|A0A1R3HVQ1_COCAP) SKP1 component {ECO:0000313|EMBL:OMO74433.1} KW=Complete proteome; Reference proteome OX=210143 OS=Corchorus capsularis (Jute). GN=CCACVL1_16727 OC=Apeibeae; Corchorus.
Sequence
MASTPKKIIVLKSSDGETFEVEEAVAFESQTIKHHLVENIETPLPCVTGKILSKVFEYCK
KHVDAAANNLEKKPEAEDDLKAWDTEFVKVDQDTLCDLFLAANNLNIKSLSDLTCKAIVH
ILMVKTPEEIDKFFDDRHSR
Download sequence
Identical sequences A0A1R3HVQ1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]