SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1R3JD49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1R3JD49
Domain Number 1 Region: 79-154
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.83e-31
Family Skp1 dimerisation domain-like 0.0000319
Further Details:      
 
Domain Number 2 Region: 7-66
Classification Level Classification E-value
Superfamily POZ domain 6.02e-22
Family BTB/POZ domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1R3JD49
Sequence length 156
Comment (tr|A0A1R3JD49|A0A1R3JD49_9ROSI) SKP1 component {ECO:0000313|EMBL:OMO92751.1} KW=Complete proteome; Reference proteome OX=93759 OS=Corchorus olitorius. GN=COLO4_17345 OC=Apeibeae; Corchorus.
Sequence
MASTSKKIMLKSSDGETFEVEEAVAVESQTIKHMIEDDCADTEIPLPNVTSKILSKVIEY
CKKHVEAAADKEKNSDDDLKTFDTDFLKVDQNTLFDLILAANYLNIKGLLDLTCQNVADM
IKGKTPEEIRTTFNIKNDFTPEEEEEVKRENQWAFE
Download sequence
Identical sequences A0A1R3JD49

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]