SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1R3RV63 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1R3RV63
Domain Number 1 Region: 1-97
Classification Level Classification E-value
Superfamily Pre-PUA domain 6.54e-33
Family Nip7p homolog, N-terminal domain 0.0001
Further Details:      
 
Domain Number 2 Region: 98-173
Classification Level Classification E-value
Superfamily PUA domain-like 6.63e-24
Family PUA domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1R3RV63
Sequence length 185
Comment (tr|A0A1R3RV63|A0A1R3RV63_ASPC5) 60S ribosome subunit biogenesis protein NIP7 {ECO:0000256|PIRNR:PIRNR017190} KW=Complete proteome; Reference proteome OX=602072 OS=Aspergillus carbonarius (strain ITEM 5010). GN=ASPCADRAFT_205633 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MRQLTEDETKTLFTKLANYTGRSLSTLVSETGDDNDRYVFRLHGSRVYYLRLSLANMATS
IPRSSLLSLGTAIGKFTKSGKFRIQLTALDVIAPHARYKVWIKQNGVMPFLYGSNVAKAH
VGRFSEDCPENAGVIVMDMNDTPLGFGVTARSSAETRRMEPTATVVFRQADIGEYLREED
TLFTT
Download sequence
Identical sequences A0A1R3RV63
jgi|Aspca1|32415|fgenesh1_pg.00609_#_56

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]