SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1R3RWG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1R3RWG2
Domain Number 1 Region: 36-207
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 8.24e-21
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00048
Further Details:      
 
Domain Number 2 Region: 356-367,410-522
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000366
Family Pseudo ankyrin repeat 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1R3RWG2
Sequence length 605
Comment (tr|A0A1R3RWG2|A0A1R3RWG2_ASPC5) Uncharacterized protein {ECO:0000313|EMBL:OOF98810.1} KW=Complete proteome; Reference proteome OX=602072 OS=Aspergillus carbonarius (strain ITEM 5010). GN=ASPCADRAFT_204526 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MEVDAESEGKLIGNTTTDRIPLDKEMKAATGSSPRRKRILLSTESAFVDNVLPSLVQNPD
IELRLITDEPSALLSGASKVPHYMDTVDSQTFEKKTGARKWLKAKAAELCEWADMLLVAP
IDAGALGSMLYGLTNTLTLALLRGWMSSKPVVLIPGMTVSEWRHPLSKRQLREVEEFWPW
ISVIPPILWESVDPEELIQLPWEGLKDLHETIEQTLGLSFSQISANPSQLSDSTYQTSLP
EQTPGDVTSTISRHLLHRVTKAENGPRLLPMELWLNVFEDQLHDWEIAKAVGIPTNLPVP
KEWQNHLLKMSTPASLEYTILRGSFAAIKKRIDSLPRWKPLSDLACHLIFKFSRTDILSY
LTENHLDLLWTTSRLTNLPYRASAIYGNPNILTWWRDAPALPNKDYIADAMDGASRAGFV
NVLEWWRTSGLELRYTERALEAASAEGRVAVLAWWKAASVNAPASTPIPLKVGKSVLLAA
QSGRTASLAWWDASGIPYTHGESVARIASTHGHVHVLDFWHRLKGSKMIFDSQVLVGPTK
NGHDNVLEWWRRSGLRVEFKTCDIEEALEDSDPVSGAEERVRTWWARNGLNLGVGTSEWM
KTKVL
Download sequence
Identical sequences A0A1R3RWG2
jgi|Aspca1|29784|fgenesh1_pg.00118_#_268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]