SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S0TZ16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1S0TZ16
Domain Number - Region: 510-545
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0144
Family Pseudo ankyrin repeat 0.053
Further Details:      
 
Domain Number - Region: 509-541,664-690,726-770
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0597
Family Ankyrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1S0TZ16
Sequence length 1529
Comment (tr|A0A1S0TZ16|A0A1S0TZ16_LOALO) Uncharacterized protein {ECO:0000313|EMBL:EFO21762.2} OX=7209 OS=Loa loa (Eye worm) (Filaria loa). GN=LOAG_06724 OC=Spiruromorpha; Filarioidea; Onchocercidae; Loa.
Sequence
MQGYASISNAEFILLPDGSNDDFSGNDFERTSSTNSFCCAAPRNSLNGQQFYSLANVPNN
YHAMENVKQKRSSKLFDRPELFVHALTEKLKGPWIEQVFLKRECIKYIPTFGTNKCGCGL
SLNAHSLAVISQFRATMIDDEVAVRSSNQSVRWSIAEHTKTSHTDAFGTLEFSGGAHAHK
AHYVRLGYDSDPSDIMYLMEKIWGLEPPRLVITVHGGITNFEVQEKLGQVFRKGMLKAAQ
TTGAWIITAGIDAGVVRHVATALDEAGISARMRSKVVTIGIAPWGLLKRHEKLIGKDIVV
SYDPHSFASKSKYATLNDRHSYFLLVDNGTNGRYGADIILRKRFEEFIARKQTIGLGTRH
VPVVCAVLEGGTCTIRAILQYLANQPPVPVIVCDGSGRASDLIAFAHRHVQENGNLPREI
RAQLLTLIASVFRYSTTPAEQILEEILCCAKHRDLLTVFRLSGNKKQDVDHAILSAILKG
QNLSAADQLALTLVWNRVDIARSDIFVANQNWNPHLLYNAMMEALALDRVDFVKLLLENG
VSMKKFLTINRLEQLYNMEQDSILPLINDSVSIIDGRITLPKIGVIIERLMGNAYKCSYT
SRKFKNKYEKCRKKALISRIPSFRSLCATYSKTRKMAEEAMSNTRKRMRRESKEGDDFQF
PFNDLMLWAVLSRRQEMARCMWSYGEEAMAKALAAIRLYKSMSKEAADEYIEVEVSNELR
EFAEEFKRESLSLLNHCYLQNDAGTLRLLTAELPNWGHHTCLSLAVIANHRRFLAHPCCQ
ILLADLWHGGLGIKSYSNLKVILALAFPPSILLLDVKARISNHRMNSFTRHSFVIEGNEF
NNEKENDDRSHNSASSSFHASEVWRIPQFTYAASLENKTENQIQDNVTLSTYDRFFETAN
LIEETLRVKSGVGDSRKSVGTSLQEVEEMARKTSWTTKFNIFYSAPITTFWIWLASYFVF
LIVYTYVILIEFPVKPTQVEWFLLAYVVGFVMEHFRKLLVQEASTLFEKIRVYFDRCWNY
LTCLAIITFFIGFAFRYNQLTRHSYGRVILSCNIVFWYIKLLDFMGVHPRLGPYIQMTGK
MIVNMMYILALLLVTLMSFGISRQAITYPHEKWQWLLIRNIFYKPYFMLYGEVYAGEIDT
CGDEGINCVPGGWIPPILMTIFLLVANILLINMLIAIFNNIFNETNAIAQQVWLFQRYEQ
VMEYENTPFFPPPFTPISHLMILLKYFWKLHQRSGRRRQWTSKRRGFFDFSMKLSLSDDE
LRLLHDFEEDCMDDLSRKKSLSQPLQVDCHLKTAVERTDNLQVQLNDMVNEDCNMKSFLR
EIESKLCVIETNHQAMLKLLRSSIDKQRNSKNLESSTEIVRKKDLSVMGKKPSTGKRESI
GKYANISNSDNEIRKLHCTDKLLETRNICQITKSFRRSFIFRNEIYTSITDTIEMPKVLY
APDDSIQPPASSSVLATQLDGTAFRNLEEVSNCTAERGIRERSIQPSAWCITDLEDMCRT
PSPEELSESANSDTNRTAIHTPPYLELDD
Download sequence
Identical sequences A0A1S0TZ16
XP_020302521.1.37734 LOAG_06724T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]