SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S0U974 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S0U974
Domain Number 1 Region: 115-194
Classification Level Classification E-value
Superfamily WWE domain 8.24e-21
Family WWE domain 0.00061
Further Details:      
 
Domain Number 2 Region: 31-77
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000197
Family RING finger domain, C3HC4 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1S0U974
Sequence length 234
Comment (tr|A0A1S0U974|A0A1S0U974_LOALO) WWE domain-containing protein {ECO:0000313|EMBL:EFO26284.1} OX=7209 OS=Loa loa (Eye worm) (Filaria loa). GN=LOAG_02203 OC=Spiruromorpha; Filarioidea; Onchocercidae; Loa.
Sequence
MNYEKEGRTEEMEGPIVDVDDSLRRPKNCDECPICYQEFAYKTELPDCGHKFCFLCIKGA
ALRQGACPLCRKSIPCNIFLDPVLATLAGQPTTVGIATSAKSISIVAENIVSRKNAEKVK
WFYGARNGGWWRYERRHESEIEEAYQHGLHSIDLLIAGSLFCINFINMFQYRKELGSKFT
RPVKRIEEGDPSLDGDVRGIAGLRTPIELNTNAEQGMSEDFKVITGNLSSLDLN
Download sequence
Identical sequences A0A1S0U974
XP_003137785.1.37734 LOAG_02203T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]