SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S0VJT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S0VJT1
Domain Number 1 Region: 128-282,368-466
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 1.31e-20
Family Pseudo ankyrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1S0VJT1
Sequence length 650
Comment (tr|A0A1S0VJT1|A0A1S0VJT1_LEGPN) Uncharacterized protein {ECO:0000313|EMBL:GAN28387.1} KW=Complete proteome OX=446 OS=Legionella pneumophila. GN=lpymg_03295 OC=Legionellaceae; Legionella.
Sequence
MPHSTNQSNVIENINQYLKWHNLPVRFGTGGVCNGLSTVHAQYVLQGREREFFELLRYVA
GDKGILDANDSVKEKVNDFVWKVVASHMTSGHDKELNQLNSFKTLSINNKPLKSVFDLPL
VTSDKNWENILESLNLKEDEVMLVRSINHAISITRKGNQYHVYDPNYEEGVKSFSSEQEV
IKELHERVFHYNKGNMGLTLSIITTGDKEPRQDLPKPVDIYDQYLNKENVNSLATITVEH
PLGGPWDLTKKTIDLASECGDENLINKLIELHQFDFNNMPIEQASQAVQYNNVRAAELLV
NDMIRILSKQDPVAQDEFSDIPAEELPAEFLKQFEEIPDAPEGDEIKEAEVQNPKVVMPP
SEKKIKDLLYPLILKAASYGRKEVFDTLCEMWNKNAGDFDKEDLKNFILLAAKGGNSVLL
QELIDKYYESNMTLYDKDIQGKVDGIIHELISKGSPDSAVCIEVLLNTLSKEGKSIDDRQ
RADYISRAFEANKPHMIERFIKGISDEKRLEFLIRAIKKDQPHMVELFIKDLPKGLLNTI
SLSLPAIEKMNGETLKILEKNGMKFTEMEKAIIAKKSHQPVGLLLSIGVALAKFTDFCKE
VLFKNESVTYDKNKFQAFKSQLNSIKTQNSLANNEPVEAQQNDQVAVYRP
Download sequence
Identical sequences A0A1S0VJT1
gi|54297992|ref|YP_124361.1| 297246.lpp2048 WP_015961268.1.101326 WP_015961268.1.17809 WP_015961268.1.19781 WP_015961268.1.21849 WP_015961268.1.30351 WP_015961268.1.3122 WP_015961268.1.3258 WP_015961268.1.35807 WP_015961268.1.36016 WP_015961268.1.37161 WP_015961268.1.39582 WP_015961268.1.41396 WP_015961268.1.41414 WP_015961268.1.43838 WP_015961268.1.44947 WP_015961268.1.45039 WP_015961268.1.46375 WP_015961268.1.46948 WP_015961268.1.48987 WP_015961268.1.49562 WP_015961268.1.54450 WP_015961268.1.547 WP_015961268.1.5553 WP_015961268.1.58425 WP_015961268.1.5861 WP_015961268.1.58655 WP_015961268.1.59183 WP_015961268.1.61482 WP_015961268.1.63249 WP_015961268.1.64714 WP_015961268.1.65356 WP_015961268.1.65604 WP_015961268.1.6601 WP_015961268.1.67348 WP_015961268.1.69880 WP_015961268.1.73276 WP_015961268.1.73409 WP_015961268.1.74197 WP_015961268.1.75016 WP_015961268.1.75926 WP_015961268.1.79423 WP_015961268.1.79768 WP_015961268.1.80208 WP_015961268.1.81040 WP_015961268.1.81849 WP_015961268.1.82883 WP_015961268.1.83690 WP_015961268.1.84032 WP_015961268.1.89129 WP_015961268.1.91040 WP_015961268.1.94262 WP_015961268.1.95686 WP_015961268.1.96370 WP_015961268.1.97870 WP_015961268.1.97946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]