SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S2M9X0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S2M9X0
Domain Number 1 Region: 4-55
Classification Level Classification E-value
Superfamily BAS1536-like 0.0000000000000863
Family BAS1536-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1S2M9X0
Sequence length 63
Comment (tr|A0A1S2M9X0|A0A1S2M9X0_9BACI) Uncharacterized protein {ECO:0000313|EMBL:OIJ21414.1} KW=Complete proteome OX=472963 OS=Anaerobacillus alkalidiazotrophicus. GN=BKP45_01160 OC=Anaerobacillus.
Sequence
MTSKNILRLYIEHKRTMMINAAYDYGFNAEITIQHSQELDELLNKYSRIIIEKQENDLPS
YQF
Download sequence
Identical sequences A0A1S2M9X0
WP_071388028.1.38785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]