SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S2ZBY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S2ZBY7
Domain Number 1 Region: 31-93
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 8.65e-24
Family Interleukin 8-like chemokines 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1S2ZBY7
Sequence length 94
Comment (tr|A0A1S2ZBY7|A0A1S2ZBY7_ERIEU) C-C motif chemokine 14 {ECO:0000313|RefSeq:XP_007517015.1} KW=Complete proteome; Reference proteome OX=9365 OS=Erinaceus europaeus (Western European hedgehog). GN=CCL14 OC=Erinaceinae; Erinaceus.
Sequence
MKVFVSALSLLLLITLTTTLGSKTEPSSRGPYHPAKCCFNFITHAVPWSRITDYYKTSSQ
CSKAGIVFITKKGHSICANPRDDWVQDYFKNLEE
Download sequence
Identical sequences A0A1S2ZBY7
XP_007517015.1.11023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]