SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S2ZUR6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S2ZUR6
Domain Number 1 Region: 48-86
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000144
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1S2ZUR6
Sequence length 301
Comment (tr|A0A1S2ZUR6|A0A1S2ZUR6_ERIEU) tubulin polyglutamylase complex subunit 1 {ECO:0000313|RefSeq:XP_007524847.1} KW=Complete proteome; Reference proteome OX=9365 OS=Erinaceus europaeus (Western European hedgehog). GN=TPGS1 OC=Erinaceinae; Erinaceus.
Sequence
MAALPAPLPSAKMAAVEKRRPAMVPAASFPDGGRPAVSRAAATAESEEDFLRQVGVTDML
RAALLKVLEARPEEPIAFLAHYFENMGLRSPASGGAGEPPGQLLLQQQRLGRALWHLRLA
HHSQRSAFNTNVGVAYECLSAGGRRKRPGLDGRTYSDLLRRICRDGEAPEEVVAPLLRRI
QCRDHEAVPLAVFRAGMLTCFVLLEFVARAGALYRLLEDPGLAVADRRVGQAVLDTLEGA
LQAGDGAPARYLEAGSRLGPDSLAQALDRALGARRPSHPMTREEFLQKAAALFIAKVKPV
G
Download sequence
Identical sequences A0A1S2ZUR6
XP_007524847.1.11023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]