SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3A7K6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3A7K6
Domain Number 1 Region: 35-107
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 1.83e-29
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1S3A7K6
Sequence length 111
Comment (tr|A0A1S3A7K6|A0A1S3A7K6_ERIEU) TSC22 domain family protein 3 isoform X3 {ECO:0000313|RefSeq:XP_007530587.2} KW=Complete proteome; Reference proteome OX=9365 OS=Erinaceus europaeus (Western European hedgehog). GN=TSC22D3 OC=Erinaceinae; Erinaceus.
Sequence
MMALPPPYSPSLFRKRDNASGASVVAIDNKIEQAMDLVKNHLMYAVREEVEILKEQIREL
VEKNSQLERENSLLKTLASPEQLEKFQSRLSPEEPAPETPQAPEAPGGSEV
Download sequence
Identical sequences A0A1S3A7K6
XP_007530587.2.11023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]