SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3B239 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3B239
Domain Number 1 Region: 2-177
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.27e-21
Family Ankyrin repeat 0.0014
Further Details:      
 
Domain Number 2 Region: 218-319
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000484
Family Pseudo ankyrin repeat 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S3B239
Sequence length 559
Comment (tr|A0A1S3B239|A0A1S3B239_CUCME) ankyrin repeat-containing protein At5g02620-like isoform X2 {ECO:0000313|RefSeq:XP_008440858.1} KW=Complete proteome; Reference proteome OX=3656 OS=Cucumis melo (Muskmelon). GN=LOC103485148 OC=Benincaseae; Cucumis.
Sequence
MHQAALKGDWKSAKQMEMMHPGALTMVISERSETALHIATRVKRAVFVEKLVERLDEHDL
ASKNKYGNTALCIAAASGAVDIAKLLVLKYKALTLIRGSGNATPVLIAARYKHKDMVSYL
LSKTPVYGLASQEQMELLLGAISADYYDIALLILEWNMSLTLQRDFNNETPLHIMARKSG
AIGKKNKPTKWESCINKWLFKHIYKKKMMQIQAYKMVELMWSVVLNVIPENKVSDFMMNP
SSMLHEAARVGNVEFLKVLTNEYPDLAWNVDGGRKSIFHVAVENRQASVFSLIYEMGEFL
DYLPYYFDEENMSLLELAAQMPDPSHLNRISGAAFQMHRELLWFKQVEKIVELTMRRKKG
KRSPRELFTQQHKGLVEDGEKWMKKTANSCMLVATLITTVVFAAIFTVPGGYTNTTTTST
TGSVIENNNNTGTPLFLYHKWFTVFVISDATALISSSTAILLFLSILTSRCAEEDFLLWL
PLKLVFGLGTLFLSVVTMVLAFSATFFLFYGKDTAWVPLLVAGDVLSLLFQLMCGQMLLG
STSHKQSVCTHTKQPNKGP
Download sequence
Identical sequences A0A1S3B239
XP_008440858.1.74646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]