SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3BAS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3BAS2
Domain Number 1 Region: 74-275
Classification Level Classification E-value
Superfamily Lysozyme-like 2.76e-77
Family Family 19 glycosidase 0.00000933
Further Details:      
 
Domain Number 2 Region: 23-65
Classification Level Classification E-value
Superfamily Plant lectins/antimicrobial peptides 0.0000000000367
Family Hevein-like agglutinin (lectin) domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1S3BAS2
Sequence length 275
Comment (tr|A0A1S3BAS2|A0A1S3BAS2_CUCME) endochitinase EP3-like {ECO:0000313|RefSeq:XP_008444611.1} KW=Complete proteome; Reference proteome OX=3656 OS=Cucumis melo (Muskmelon). GN=LOC103487878 OC=Benincaseae; Cucumis.
Sequence
MEGGVAMQKTLLLTAVALIGIIAGAAAQNCGCAAGLCCSRFGFCGTGEDFCGTGCREGPC
NIPPLTPSVNDVNVAEFVTEEFFNGIINQADASCAGRGFYSRATFLEALQSFDRFGRIGT
VDDSKREIAAFFAHVTHETGHFCFIEEIDGATRDYCDEENTQYPCNPSKGYFGRGPIQLS
WNFNYGPAGENIGFDGLNNPEIVATNPVVSFKTALWYWMNFVRPVINQGFGATIRAINGA
LECDGANTATVQRRVQFYNQYCNQLNVDPGNNLTC
Download sequence
Identical sequences A0A1S3BAS2
XP_008444611.1.74646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]