SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3CUB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3CUB2
Domain Number 1 Region: 27-206
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.33e-19
Family Ankyrin repeat 0.0073
Further Details:      
 
Domain Number 2 Region: 271-350
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000876
Family Pseudo ankyrin repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1S3CUB2
Sequence length 625
Comment (tr|A0A1S3CUB2|A0A1S3CUB2_CUCME) uncharacterized protein LOC103504614 {ECO:0000313|RefSeq:XP_008467210.1} KW=Complete proteome; Reference proteome OX=3656 OS=Cucumis melo (Muskmelon). GN=LOC103504614 OC=Benincaseae; Cucumis.
Sequence
MNPLPRTVVHVLQQRERKENLEERINLYRTALEGDWDNALYILDRNQSLLSASITRDKET
ALHIAAGAKHINFVEELVRKMSKEEVGKKNRHGNTALCFAAASGVVRIAELMVEKNEDLP
LIRGFGNVTPLFMAVSYKCKPMALYLLSVTKLTELTSQEKIELLIATIHSDFFDISLEIL
EHDTTLATKNDTKNNNETALHVMARKPSAIDSGDQLNFWKNCINSVKGISNKEEEIMKTS
ARELVESLWKHVVYELPKKQMLNFIRHPSRLLHDAASVGNVEFLVLLIRRYPDIVWEEDD
DGKSIFHVAVENRLEDVFNLIYEIGGLKDFSAKYRTTVKGKYNILHLAAKLAAPNHLNRV
SGAALQMQRELIWYKEVEKIVLSSQLEAKCDDHLKLTPRELFTIEHQDLRKDGEAWMRNT
ANSCMLVSTLIATVIFAAAFTVPGGDDSEGTPIFRRKFWFTIFVISDAVGLISSSSSILV
FLSILTSRYAEHDFLHSLPSRLLIGFTSLFVSIVCMVVAFSATFFIHYHNNANMWVPTIV
ATTTIVPVCCFCVLQFKLWVDIYYNTYLSKFLFRPRQRKLSLSSPITAFFSYTTITSSST
LPLAKAIENESSERTDTVHPHFTLR
Download sequence
Identical sequences A0A1S3CUB2
XP_008467210.1.74646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]