SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3EM85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3EM85
Domain Number 1 Region: 8-50
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000000654
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1S3EM85
Sequence length 151
Comment (tr|A0A1S3EM85|A0A1S3EM85_DIPOR) Sperm autoantigenic protein 17 {ECO:0000256|PIRNR:PIRNR016533} KW=Complete proteome; Reference proteome OX=10020 OS=Dipodomys ordii (Ord's kangaroo rat). GN=Spa17 OC=Heteromyidae; Dipodomyinae; Dipodomys.
Sequence
MSIPFSNTHYRIPQGFGNLLEGLTREILREQPENIPAFAAAYFENLLEKREKTNFDPAEW
GAKLDDRFYNNHAFKDQEQPVKCDLVQEMSSTSEKKEDERATALASPEEEEEEKEKEENA
AVKIQSVFRGHMAREEMKKMKDKQENGEETK
Download sequence
Identical sequences A0A1S3EM85
XP_012865059.1.60039 XP_012865060.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]