SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3FGH9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3FGH9
Domain Number 1 Region: 50-235
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.56e-47
Family Ankyrin repeat 0.00019
Further Details:      
 
Domain Number 2 Region: 277-338
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000255
Family SAM (sterile alpha motif) domain 0.025
Further Details:      
 
Domain Number 3 Region: 247-301,386-420
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000131
Family Pseudo ankyrin repeat 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1S3FGH9
Sequence length 476
Comment (tr|A0A1S3FGH9|A0A1S3FGH9_DIPOR) ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 {ECO:0000313|RefSeq:XP_012875410.1} KW=Complete proteome; Reference proteome OX=10020 OS=Dipodomys ordii (Ord's kangaroo rat). GN=Asz1 OC=Heteromyidae; Dipodomyinae; Dipodomys.
Sequence
MAAPSELRGPSMAGGRESSDSEDDGWDIGSLDRSSQKFRRPLPVEEKNEAFKKALTTGDI
SLVEELLDSGINVDSSFQYGWTPLMYAASVANVELVRFLLDRGANASFSKDKVTILITAC
SASGSEEQILKCVELLLSRNADPNVACRRRMTPIMYASRYGHTQVVVLLVAHGAEVNAQD
ENGYTALTWAARQGHKNVILKLLELGANKMLQTKDGRTPSEIAKRNKHLEIFSFLSLTLN
PLEGKLQQLTKEETLCKLLAADSDKEKDHIFSSYTAFGELEIFLHGLGLEHMTELLKERD
ITLRHLLSMKKDEFTKNGITSKDQQKILAALKELEVEEINFGELPEVAKLEISGDEFLNF
LLKLNKQCGHLITAVQNIITELPVNSQKIVLEWASPRNFTSVCEELVTNVENLSEEVCKL
KDLIQKLQNERENDPTHIPLMEEVSTWKSRVLKWTAITVCGFGLFLFICKLTFQRK
Download sequence
Identical sequences A0A1S3FGH9
XP_012875410.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]