SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3GN28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3GN28
Domain Number 1 Region: 23-192
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 5.36e-68
Family Crystallins/Ca-binding development proteins 0.00000571
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1S3GN28
Sequence length 194
Comment (tr|A0A1S3GN28|A0A1S3GN28_DIPOR) beta-crystallin S {ECO:0000313|RefSeq:XP_012890221.1} KW=Complete proteome; Reference proteome OX=10020 OS=Dipodomys ordii (Ord's kangaroo rat). GN=Crygs OC=Heteromyidae; Dipodomyinae; Dipodomys.
Sequence
MVMHACNISHSSGKVLLFYSVLQITFYEDKNFQGRRYDCDCDCSDFHSYLSRCNSIRVEG
GTWAVYERPNFAGHLYILPQGEYPEYQRWMGLNDRLGSCRAIHLSSGGQYKIQIFEKGDF
NGQMFETTEDCPSVMEQFHMREIHSSKVLEGVWIFYELPNYRGRQYLLDKKEYRKPIDWG
AASPAVQSFRRIIE
Download sequence
Identical sequences A0A1S3GN28
XP_012890221.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]