SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3GR03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3GR03
Domain Number 1 Region: 130-318
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.19e-32
Family Nucleotide and nucleoside kinases 0.0000436
Further Details:      
 
Domain Number 2 Region: 4-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000256
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S3GR03
Sequence length 406
Comment (tr|A0A1S3GR03|A0A1S3GR03_DIPOR) adenylate kinase isoenzyme 5 {ECO:0000313|RefSeq:XP_012891328.1} KW=Complete proteome; Reference proteome OX=10020 OS=Dipodomys ordii (Ord's kangaroo rat). GN=Ak5 OC=Heteromyidae; Dipodomyinae; Dipodomys.
Sequence
MNTNDAKEYLARREIPQLFESLLNGLMCSKPEDPVEYLESCLQKVKEMGGCDKVKWDTFV
SQEKKTLPPLNGGQSRRSFLRNVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIE
EYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERYGFQYISVGELLRKKIHSTSSNRKW
SLIAKIITNGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPDLV
VFLACANQRLKERLLKRAEQQGRPDDNLKATQRRLINFKQNAAPLVKYFQEKGLIMTFDA
DRNEDEVFYDISMAVDNKLFPNKEAAAGSADLDPSMVLDAGEIIDAGSDYEDQNMDPFTG
EKNVSEGPVVPARVVALGSNAMGRLRGAPDRDTRGGQQKGHRRDGR
Download sequence
Identical sequences A0A1S3GR03
XP_012891328.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]