SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3GRV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3GRV6
Domain Number 1 Region: 63-119
Classification Level Classification E-value
Superfamily Kringle-like 7.14e-16
Family Fibronectin type II module 0.0038
Further Details:      
 
Domain Number 2 Region: 30-72
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000154
Family Fibronectin type II module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S3GRV6
Sequence length 121
Comment (tr|A0A1S3GRV6|A0A1S3GRV6_DIPOR) binder of sperm protein homolog 1 isoform X2 {ECO:0000313|RefSeq:XP_012891623.1} KW=Complete proteome; Reference proteome OX=10020 OS=Dipodomys ordii (Ord's kangaroo rat). GN=Bsph1 OC=Heteromyidae; Dipodomyinae; Dipodomys.
Sequence
MRHSVVWMLLAGGLWGLDVCSVLAVLSNTSCIFPFSYVDGIHFSCTSIHSDYDWCSLDST
FRGRWRYCTAKDPPVCVFPFTFKKWCFRQCTKKGYVLGRSWCSLTHNFNKDRKWKQCSPQ
Q
Download sequence
Identical sequences A0A1S3GRV6
XP_012891623.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]