SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3HFM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3HFM4
Domain Number 1 Region: 206-265
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000889
Family Pseudo ankyrin repeat 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1S3HFM4
Sequence length 671
Comment (tr|A0A1S3HFM4|A0A1S3HFM4_LINUN) short transient receptor potential channel 6-like {ECO:0000313|RefSeq:XP_013384878.1} KW=Complete proteome; Reference proteome OX=7574 OS=Lingula unguis. GN=LOC106154886 OC=Lingulata; Lingulida; Linguloidea; Lingulidae; Lingula.
Sequence
MGDSNARTTNPSDFSKQTPGLDDSSPPLLSPSTRNSSSSSKSIGGRRGGAGDKVDVANET
LLGSISKPPPAAAPQHVPPLPSPPPPPPSKDRSQISNNQTATSKPSDQPSPEEPRAPVEN
VDEGDYASPIGAAPHSRLPTDITATLGDGGRYGNIEPVYRAKLKKRKFILCYDCGFTSSS
EDEGPQHPPDKPTAGKTSGPMHSRDNLRKAIDDGANLDEIKLALKQWLSLSVKDTSYNPM
LQAAMKNDIEVCQLLKDEEHLKITDPHDYFCDCYLDRNDTLNHALYRVNAYRAMTSSSYL
LTQKDPVNSALKFRQKLFTMAKQDEEFKSEYLKLTQKCETFAWEMLDLVRGRDELSLILD
KSANGCSELARVRRVMDEGAKKFVAHPYVQRHLRMVFYGVDPNIRRRMLTTNNFLKTIFI
VLALPVWILLFLAYILFGSFETLEKKSKFIKWNNMFLRTPCIKFYTHSFSYFTFLLILTI
YFLPDDKANVAHAKDFRWSEYAIFFYVIGYLLAEVKQLCRQGMRYFQNAFNILDILLVMF
YLASFVSRIVSIVKTRQAALEVNQTTTEAYTYYYQIGRFEWELNDPEIISDALFALANII
SFSRLVYILPTFESVGPLLVVLGKMINDVFRFAALLLIVFIAFTVGLHNHYHFYAGQTLP
DGSKTNSAFHG
Download sequence
Identical sequences A0A1S3HFM4
XP_013384878.1.76062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]