SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3HH64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3HH64
Domain Number 1 Region: 22-64
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000432
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1S3HH64
Sequence length 229
Comment (tr|A0A1S3HH64|A0A1S3HH64_LINUN) tubulin polyglutamylase complex subunit 1-like isoform X2 {ECO:0000313|RefSeq:XP_013385372.1} KW=Complete proteome; Reference proteome OX=7574 OS=Lingula unguis. GN=LOC106155203 OC=Lingulata; Lingulida; Linguloidea; Lingulidae; Lingula.
Sequence
MAEKRKTSTGIIGDDRNQESDRHFLERTSVNNIIKDMLAKVLENRPANPVVYIAEYFENL
DEKSNKVTQAHRQLLLTHHSRPAFENNVRQAYESLGVHRANRSTLGVNGLVFTELLQVIC
RDFPEAVKEKVMKKLACRDWEVVTHDVFRSAIFTCFVLKDFLQEAESLYWSIDLKHNGEA
DKVLCDAVLHQILIAVSSSESDPKCVMDAGYSLAPDRLYMALNKVKGFK
Download sequence
Identical sequences A0A1S3HH64
XP_013385372.1.76062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]