SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3HL03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3HL03
Domain Number 1 Region: 191-478
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.36e-69
Family Ankyrin repeat 0.0000196
Further Details:      
 
Domain Number 2 Region: 484-678
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.75e-51
Family Ankyrin repeat 0.00011
Further Details:      
 
Domain Number 3 Region: 51-132,196-234
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 3.27e-24
Family Pseudo ankyrin repeat 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S3HL03
Sequence length 838
Comment (tr|A0A1S3HL03|A0A1S3HL03_LINUN) transient receptor potential cation channel subfamily A member 1 homolog {ECO:0000313|RefSeq:XP_013386790.1} KW=Complete proteome; Reference proteome OX=7574 OS=Lingula unguis. GN=LOC106156210 OC=Lingulata; Lingulida; Linguloidea; Lingulidae; Lingula.
Sequence
MFRRSVDSFVPGGGPGGVSKRNVPKHGRDNMEMSTNIGMRRGEPKDTPTLTLHQCVRDGN
PDKLLYLLDNFGNVTKKINALDESKLSPLHYAARYNHFEVVKILVERGADVNKKGKDDLT
PLHLAARCKRMKRTKSTDSLDEVEGNGAPLTPASSEATVETAVSNEEERGDGDDVPNGAV
REEAASDDELDNQPSVVKYLIERGANVNAQDYYGLTPLHFAAMRGNDRVCRELLSVPDIY
IEAADKQQMTALHLAAAHSCVEVAQILIEAGANLRCIDHESCTPLHLAAEKGNIEIVGML
FDAGQKKDGWVTLSQMVTDQNVEQNTALHLAVNNSHYEVAKLIIEKGGLDNETSKYLSTP
LHLASVGGDVRVVQLLLDSNARVDALNHNQETPLHKAAENDHPEVVELLLKSNADIEKRN
EDNCTALLLAACWGNPEVIKVLLKYNADPSAADKNEKTAIFWAAENNHVSCLQVLLKNPK
VTKLIDEPDRYGNTPLHIAAQLGHINCVKLLMEHNAMVDDKNEDEQTPLHLAAMYDQPLV
VRELVNKQKTIIYDGDEDSNTALHLAALAGHQRVMDVLLDLGAGVETRNAKGWTALDCAA
YMGKVKAAETLLKAHSPIDPLDKEKVTPLHLAAKGGHTEMVEFLMKMGANIAQRDQNGLN
CLDMAIDCNHENVAMAIVKSDKWEEAMKNQTAVSKDLGKDTPLRKLIRKMPDVAEKVFNK
CMKPNMTNLENSDCEIIFNYEYLDDTFADWGEKSDDGSCSDSIYDEDTHIIKPDVPPYSK
DSRILKKNHPLQIMVSSKREDLLSHPLVASLLKHKWQKFGAAFYYINLIIYSVFLTFL
Download sequence
Identical sequences A0A1S3HL03
XP_013386790.1.76062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]