SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3JTU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3JTU8
Domain Number 1 Region: 24-113
Classification Level Classification E-value
Superfamily AbfB domain 3.53e-16
Family AbfB domain 0.0034
Further Details:      
 
Domain Number 2 Region: 120-163
Classification Level Classification E-value
Superfamily AbfB domain 0.000000000000119
Family AbfB domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S3JTU8
Sequence length 172
Comment (tr|A0A1S3JTU8|A0A1S3JTU8_LINUN) probable alpha-L-arabinofuranosidase B isoform X2 {ECO:0000313|RefSeq:XP_013413772.1} KW=Complete proteome; Reference proteome OX=7574 OS=Lingula unguis. GN=LOC106176090 OC=Lingulata; Lingulida; Linguloidea; Lingulidae; Lingula.
Sequence
MPQVPWYMYFALFLCVSMAHGQVYYIRSQNYPAYTWGYDVKGEAYIMTELGQRLFRIITP
GLTEQPNTISFESYDHPGYFLRHYGYKLHLEHSSRPRNSHIFAQDSTFFVRENKWFPEYT
AYESVNFPGYFIRHSGYRLQINKLDGSDLFKKDSSFVLNAGSDCRQPAIVGK
Download sequence
Identical sequences A0A1S3JTU8
XP_013413771.1.76062 XP_013413772.1.76062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]