SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3KPM9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3KPM9
Domain Number 1 Region: 476-763
Classification Level Classification E-value
Superfamily RNI-like 3.14e-38
Family 28-residue LRR 0.033
Further Details:      
 
Domain Number 2 Region: 254-517
Classification Level Classification E-value
Superfamily RNI-like 2.55e-35
Family Cyclin A/CDK2-associated p19, Skp2 0.0032
Further Details:      
 
Domain Number 3 Region: 11-53
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000863
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1S3KPM9
Sequence length 822
Comment (tr|A0A1S3KPM9|A0A1S3KPM9_SALSA) F-box/LRR-repeat protein 13 isoform X1 {ECO:0000313|RefSeq:XP_013980643.1} KW=Complete proteome; Reference proteome OX=8030 OS=Salmo salar (Atlantic salmon). GN=fbxl13 OC=Salmoniformes; Salmonidae; Salmoninae; Salmo.
Sequence
MASLQNADPALREYILKHSLTQIFQALLTGLCVSCPESPLHFLERKIVSIQENRDTAEID
WHTCVDDPEQVAVTSLAGSMVHDIFGKRDDTLFLSHLFEKAYSCYRIRLTNMCFKAWKRF
IWNKRKEARELTLKMETAERHYIQRGLRVALCKWVEWVQVCKRRQNDAMKKIQRVWNAIH
CKIVISAWRYVVQDSKRTKEYFERLENGLLEMSSKDSDVAIEEGHDGLSLLPCKLSIKVF
QSLDVGDLLKCAEVCRTWKAIAQSCSLWSRISFSVERDWITDRIVEQILQKYRPFVVHLN
MRGCTSLQWPSFKCISECRNLQELNLSECFNIKDEMVCMILEGCPTLLYLNLSFSYVANG
TLRELSRSCLNLQFLSLACCRRFTDKGLQYLASGKGCHKLIHLDLSGCTQQISVEGFRYI
AAGCPLLQQIVFNDMPTLSDSCVLELASKCHSLSAISLWDTPHLSDSAFKAIAEVANLTK
FSVDGNSRMSDISWRALCRSSPGLTRLHAADCPRMTDSSLKSMGALKNLVYLNISHCSRV
SDMGLRYLTEGPSASKLRELNLSNCSRINDLAIMRVAQKCSKLNHLSVSYCDNLSNSGLE
WLSSCSSLLSLDISGCNIMDQGLIALGGNPGLKKLVASECVWITDIGIEKFCRQARGLEY
MDVSHCVALSDQAIKALSFYCRTIVTLRMPGCPKMTDLAVQYLTVGRHFLRELDVSGCVL
LTDRTPRFLQTGCPQLNTINMVYCRGISKQAALRLQPCVEKWEHSNDDAPYWFGYDSLGQ
LLQPIGRPDKIQDTWEEEEPAPRNNKKRNLIKACGEDYEYTA
Download sequence
Identical sequences A0A1S3KPM9
XP_013980643.1.97760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]