SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3M5R2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3M5R2
Domain Number 1 Region: 129-368
Classification Level Classification E-value
Superfamily vWA-like 7.08e-69
Family Integrin A (or I) domain 0.000000607
Further Details:      
 
Domain Number 2 Region: 32-89
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000837
Family Plexin repeat 0.00097
Further Details:      
 
Domain Number 3 Region: 392-452
Classification Level Classification E-value
Superfamily Integrin domains 0.00000000256
Family Integrin domains 0.0055
Further Details:      
 
Domain Number 4 Region: 542-582
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000234
Family Integrin beta EGF-like domains 0.0032
Further Details:      
 
Domain Number 5 Region: 500-538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000446
Family Integrin beta EGF-like domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1S3M5R2
Sequence length 725
Comment (tr|A0A1S3M5R2|A0A1S3M5R2_SALSA) Integrin beta {ECO:0000256|RuleBase:RU000633} KW=Complete proteome; Reference proteome OX=8030 OS=Salmo salar (Atlantic salmon). GN=LOC106570589 OC=Salmoniformes; Salmonidae; Salmoninae; Salmo.
Sequence
MTSWLRKYDNPVLLFLLLAANITSGSSRSGESVCSSPPVSSCSECLRRGPRCAWCFQEGF
LDGAEVGKRCDLAVTLTRRGCGLEFIENPEVMVEVNPTTSRTQVSPGEITLTLRPGAEAS
VVVAVQQLERYPVDLYYLVDVSASMQENLDQLKKVGVALSNRMREHSSDLRLGFGSFVDK
NVSPYINVHPSKINNPCSDYEVKCLPAHGFHHVLSMTSNMSEFTRIIKRQRISGNMDTPE
GGLDAMLQATVCQGEVGWRGEAKRLLLLMTDQPSHLALDSRLAGIVTPHDGLCHLENSVY
MKSSTMDHPSLGLLAEKLLENHIYSLFAVDKLQYQWYEELVRLLPGSNLLFQAPNLIDLV
VDAYKRLLSVVQVSVSVEDRAFSRFLVSVSPLCPEGSESHDRSCSNVQPNQTVYFNITIG
LLSCPDNDDDDEDDVVQVFVRPVGYNESAVIKTPELDLERSWQCGAAGSEVDCSARGVCV
CERCVCERNSLGTVYGAYCQMDDYSCPYQHQVLCGGRGMCVSGECVCEEGWTGESCGCPV
STATCLLNNGLLCSGRGRCVCGRCMCDDHQHSGEFCERCPTCHSSCQSHCVDTVSVWTVY
LCGQCGQCICVDSVSVLTVCLCGQCVCVDSVDSVSVWTVCLCGQCVCVDSVDTVSVWTVY
LCGQCGQCICVDSVSVLTVCLCGQCVCVDSVDSVSVWTVWTVCLCGQCICVDSVDSVSVW
TVYLC
Download sequence
Identical sequences A0A1S3M5R2
XP_013998517.1.97760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]