SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3MJ69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3MJ69
Domain Number 1 Region: 121-252
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.09e-33
Family cAMP-binding domain 0.00000112
Further Details:      
 
Domain Number 2 Region: 255-392
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.49e-32
Family cAMP-binding domain 0.00000249
Further Details:      
 
Domain Number 3 Region: 2-41
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000366
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S3MJ69
Sequence length 405
Comment (tr|A0A1S3MJ69|A0A1S3MJ69_SALSA) cAMP-dependent protein kinase type II-beta regulatory subunit-like isoform X1 {ECO:0000313|RefSeq:XP_014003135.1} KW=Complete proteome; Reference proteome OX=8030 OS=Salmo salar (Atlantic salmon). GN=LOC106573038 OC=Salmoniformes; Salmonidae; Salmoninae; Salmo.
Sequence
MSIEIPEGLTELLQSFTVEVLRNQPGDLLEFALQYFTQLKDSEIRGAAIGNDQNSATRPS
GKAVNFIEEAMQIDSENGEEESDDEEFTAPVMSRFIRRASVCAEAFNPDEDEEDKEQRVT
HPKTDEQRQRLQEACRDILLFKNLDPEQFSQVLDAMFEKFFEVGEHIIDQDADGDNFYVI
ERGMFDICMRVDGIEKTVGAYDNRGSFGELALMYNTPRAATIIATSPGALWCLDRLTFRR
IIVKNNALKRRLYEEFIESLPFLTSLELSERMKVVDVLSSKPFSDEEQIISQGDLADCFY
IVESGQVRITMKRSRTKKDQEDEEVDIATCSRGQYFGELALVTNKPRAASAYAVGSVKCL
VMDVQAFERLLGPCMDIMKRNIANYEEQLVTLFGNSTTDIEGENL
Download sequence
Identical sequences A0A1S3MJ69
XP_014003135.1.97760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]