SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3NW25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3NW25
Domain Number 1 Region: 17-57
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000445
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1S3NW25
Sequence length 222
Comment (tr|A0A1S3NW25|A0A1S3NW25_SALSA) ropporin-1-like {ECO:0000313|RefSeq:XP_014019450.1} KW=Complete proteome; Reference proteome OX=8030 OS=Salmo salar (Atlantic salmon). GN=LOC106581727 OC=Salmoniformes; Salmonidae; Salmoninae; Salmo.
Sequence
MSRPNSSGSECSHTGMSVHIPQELPDFLLQFTKDAIRAQPEDIIEYSTAYFTAMVKGQPF
SVKPNPEAKLELTNEILGILHSQLSERGTVRKLEIGLIWKSLNMPENTFNHILSMGKFGE
EIEWNKFLASCCSYLGKSVKDALTQACYIMNCDSNCKPPDACVSFETFRFLYTYLAVGNE
NISQSQIDRVLRYLQKRAISNNGVVKVSDFINNRKLRLDPTN
Download sequence
Identical sequences A0A1S3NW25
XP_014019450.1.97760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]