SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3PRH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3PRH1
Domain Number 1 Region: 300-423,454-500
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.32e-27
Family Nucleotide and nucleoside kinases 0.00033
Further Details:      
 
Domain Number 2 Region: 90-288
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.16e-20
Family Nucleotide and nucleoside kinases 0.00088
Further Details:      
 
Domain Number 3 Region: 208-236
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.00000183
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0021
Further Details:      
 
Domain Number 4 Region: 45-79
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000706
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1S3PRH1
Sequence length 509
Comment (tr|A0A1S3PRH1|A0A1S3PRH1_SALSA) adenylate kinase 8 isoform X1 {ECO:0000313|RefSeq:XP_014030300.1} KW=Complete proteome; Reference proteome OX=8030 OS=Salmo salar (Atlantic salmon). GN=ak8 OC=Salmoniformes; Salmonidae; Salmoninae; Salmo.
Sequence
MTPITFSLATCECVLASDLDSCYKLTANHLIAMDETAKPLRIPPEMAIYAEKHEIFDLVQ
TLVTNLMVDKPEDPIQYLIVLLKRGSVEVPRVMLLGPPASGKRTVARKLCEHTQVIHITD
SNILQEDTDLTKKALQYKAKQQEIPCDLWIKLIQQRLSKIDCVRRGWVLEGIPQTREEAL
SLQEAGVAPNHVVLLEAPDAVLIERSQGKRIDPVTGDVYHVTFIWPEDKEVVQRLERQKT
VSEEQLVAQLMQHHREVHALRKTYRNCLKGIDADQPHVDVFDQVLTYILSRHCSVAPHTP
RVLLFGPPGSGKSLQAKLISQKYNIVNLCCGELLEAVSADVTNMGELIKPYLESGQQVPD
SMVLQILTERLSRLDCTTRGWVLHGFPRDLEQAEKLQESNFIPSRVFFLEMTDDVAIERV
TLRSIDPFTGEKYHSLYKPAPSPEVQTRLQFNPKDSEAQLLRQLKEYWANASSLQDLYPE
AVHINADQDPHTVFESLESRLVGRLQNDA
Download sequence
Identical sequences A0A1S3PRH1
XP_014030300.1.97760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]