SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3QSY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3QSY0
Domain Number 1 Region: 130-318
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.16e-32
Family Nucleotide and nucleoside kinases 0.0000563
Further Details:      
 
Domain Number 2 Region: 4-46
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000706
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1S3QSY0
Sequence length 412
Comment (tr|A0A1S3QSY0|A0A1S3QSY0_SALSA) adenylate kinase isoenzyme 5 {ECO:0000313|RefSeq:XP_014043096.1} KW=Complete proteome; Reference proteome OX=8030 OS=Salmo salar (Atlantic salmon). GN=ak5 OC=Salmoniformes; Salmonidae; Salmoninae; Salmo.
Sequence
MNTNDAKEYLTRREIPQLFESLLTGLMYYKPEDPIDYLEVCLKKVRELGGPDRVRWDTFV
GQEKKSLPPINGGQSRRSFFRNVLPDSPNFPYRRYDRLPPISQFSIESDSDLSETAELIE
EYEVFDPSRPRPKVILIIGGPGSGKGTQSLKIAECYGFQYVSVGELLRKKMIHNATSNRK
WSLIAKIITNGELAPQETTITEIKQKIMKIPDANGIVIDGFPRDVGQALSFEDQICTPDL
VVFLSCANHRLKERLEKRAEATGRPDDNPNATERRLTNFKQNTIPLVKYFQERGLIVTLD
ADRDEEEVFCDISMTVDNKLFPSKQPVAGPSELDLSLLGDNTSLVDVPFRNEEQVEEEEE
EEEEEMGYAEGTAESYPADRKKPKVVFLMGMYTHTHTHTHTQCYSVTVVVPA
Download sequence
Identical sequences A0A1S3QSY0
XP_014043096.1.97760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]