SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3R3K8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3R3K8
Domain Number 1 Region: 8-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000392
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1S3R3K8
Sequence length 1019
Comment (tr|A0A1S3R3K8|A0A1S3R3K8_SALSA) uncharacterized protein LOC106599672 {ECO:0000313|RefSeq:XP_014046437.1} KW=Complete proteome; Reference proteome OX=8030 OS=Salmo salar (Atlantic salmon). GN=LOC106599672 OC=Salmoniformes; Salmonidae; Salmoninae; Salmo.
Sequence
MPYPHRVVNIPTGFKDLLEGVSKAVVKYQPESIPAFAAVFFNALLVFRDEKPGMPIHELM
KEFRATKGSHFYRKKNKAVKPQVQPQVTVQGPERSPHPKPILEWEAGPLLMEARCEDVRE
PFSFISSDQPCSSRDIQAMDAVASTDGGQNECGLQVSATTITLSTGPIPADIAQGLALYR
RKIDLESSPRDSPPLGASANNSCARVCSALFERVSFSEISQELDAVLIQTDVLPSESLII
VQTEHVPEMIVFQAHPLLAENAAVAPPPCDVPVRSKCSCASMVGALEDVMAPLEVDGTSQ
PSYPILASICERAAPVVERPAAMVAEPEESPALEVHSAPVEPQEMTPSRPSIPVGTLELP
VSAPAVSDSPAMAVQEVQISVTDRPLAVILHSLSGATSPSETAEDVMLVPMVVSPPESVK
KASRESSDFLCPLPAATLETESVSVICPPPSPVTVEIQPSILASPLTAATVETESSNRIC
PPSVVSVETELANMLSPSAAETVEADSSVVTCPHTAVTDDFVAPVSVCLPVVALEETGVP
SVQLPAPAPALTEETLCQSASPCLPTVTAAGESRTPFLVYLPLPAPELAKTPGLLCQLGL
GPEEAKSFPFLCLPISDIPRTPSLVTAGLAPAQTAAVAPAAAPDLPRTNLPGVTDIPRTL
SYVAAGAQELPRLQSYAANTAEVQEPPRTPSYLANTPGVQEIPHNPSYLKNPAVFQDMCF
MCPSVTASNLSRNNSFVHSPAAMAPQQLIRGPCMVSLYPQGGPVMGHCTHSPGQCPASLQ
QQAGMAPLNHGQQTNTNFMPICSQRPSLCSCLSRTGSHWRFCHLTRPESQGRVGGMICPY
QNSQTMMHCNSLDHMANIPMYQDCGHYSSSCHLLPPCSQSSHGSLHTHHMEEPRCSAYNL
GTSFVQPQPQTCSSDPLFHFPQQYHLVATPSQERQQALCPLQCPLLQQRHSSLLFCGHQG
ELSRLGCSSCVPATNQRQNQGGVEQKNNIPSCASLHDKRLDTSSNNNHGCVMNCNPQGN
Download sequence
Identical sequences A0A1S3R3K8
XP_014046437.1.97760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]