SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3RFY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3RFY6
Domain Number 1 Region: 187-303
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 6.15e-41
Family eIF-2-alpha, C-terminal domain 0.000000968
Further Details:      
 
Domain Number 2 Region: 90-183
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 2.75e-31
Family eIF2alpha middle domain-like 0.00000434
Further Details:      
 
Domain Number 3 Region: 12-93
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.57e-17
Family Cold shock DNA-binding domain-like 0.0000217
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1S3RFY6
Sequence length 315
Comment (tr|A0A1S3RFY6|A0A1S3RFY6_SALSA) eukaryotic translation initiation factor 2 subunit 1-like {ECO:0000313|RefSeq:XP_014050679.1} KW=Complete proteome; Reference proteome OX=8030 OS=Salmo salar (Atlantic salmon). GN=LOC106602525 OC=Salmoniformes; Salmonidae; Salmoninae; Salmo.
Sequence
MPSLSCRFYQHRFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFTRTAWVFDEKYKRPGYGAYDVFKQAVADPAVLDCLDLTEEEKAVLIDNI
NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLGCSTDAMPIKINLIAPPRYVMTTT
TLERTEGLSVLNQAMAAIKEKIEEKRGVFNIQMEAKVVTDIDETELARQLEQLERENAEV
DGDDEDGEMEAKAED
Download sequence
Identical sequences A0A1S3RFY6
XP_014050679.1.97760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]