SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S4CHC7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S4CHC7
Domain Number 1 Region: 121-196
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 5.76e-23
Family Skp1 dimerisation domain-like 0.00024
Further Details:      
 
Domain Number 2 Region: 46-104
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000785
Family BTB/POZ domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1S4CHC7
Sequence length 207
Comment (tr|A0A1S4CHC7|A0A1S4CHC7_TOBAC) SKP1-like protein 11 {ECO:0000313|RefSeq:XP_016500600.1} KW=Complete proteome; Reference proteome OX=4097 OS=Nicotiana tabacum (Common tobacco). GN=LOC107819038 OC=Nicotianoideae; Nicotianeae; Nicotiana.
Sequence
MPIPIPLHSLLWNFFLKPSASPNFFLRKTFLMASSSKITPATENKVLILKSNDGDEFQLE
ESIAIGSVTIKNMVEDDCASNIIPLPNVDTETLIKTIEYLKKHAEISGSDEEEEEIKKTK
IKDFDKEFVSVKMQKLFNIILAANFLDIKPLLDLCAQAIADKIKNKSHVAVRKIFNVECD
YTKEEEDAIRKDNEWAFEGEEFDESLD
Download sequence
Identical sequences A0A1S4CHC7
XP_009607248.2.42874 XP_016500600.1.3737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]