SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S4EYW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S4EYW7
Domain Number 1 Region: 1083-1165,1274-1466
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.62e-33
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 943-1047
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 8.24e-16
Family Pseudo ankyrin repeat 0.034
Further Details:      
 
Domain Number 3 Region: 10-96
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000282
Family Ankyrin repeat 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1S4EYW7
Sequence length 1505
Comment (tr|A0A1S4EYW7|A0A1S4EYW7_AEDAE) Uncharacterized protein {ECO:0000313|VectorBase:AAEL001438-PA} OX=7159 OS=Aedes aegypti (Yellowfever mosquito) (Culex aegypti). GN= OC=Culicidae; Culicinae; Aedini; Aedes; Stegomyia.
Sequence
MSKNHNYLEAAQTGDLSALKFYIGMHPEEVDINYQDVKLCSALHRAVHSRRNSHETVKML
IEAGIDCGLRNEQNQTAAEMARHLGRGDLMLLMLEWEFRDVPKREIFYQLLRRNSMEMIC
IYTIQWKLPFAEAIGLIEEAFEALRLKGVKLEEQTRYEALQELVKHYGANPTTYREVTIG
KDELLAYIDFVLQHTDEDNLNETSDEVLMVMREIVKQMYLGKKRYDEAMMEVQQCLCVFV
ATCDGLPGMEDFTLIINKQLVLRFLRLVAKQLRTGSGILSSRDRKVRRQLRKTFVLLKEW
NSVMKIVYYLSKACEIDLNQPDDRIAKQLFLDRCVQVVGEAIKSTKLTPNLSRRMQTAFE
FMTSGGTASCYKSIREFHSHGYPVAKYLFEKENDFNSYMKLQENFKTVLSFFESMRSTLM
VVIQKRFLGSLYRMQTIKQVRSFAMYANENIIGSFGDPAAHQETFYNEKIAMKLIDELVI
LLKEDSENFSTLTEIEKQLKSHFEDMSKARFNHLQLGQSFGNFLRVARSCQNTTDLRSVL
KFALVTPGPKCFIECYSQKRLQIDRLTRTLMYHLMDSYGASRDQQIINVAFQLLNTLDSE
SASGLHKVQLKRTNFASEDYVEEILCESGAYDHFREIPSAVRNSLRKNVEKNIFNVADRF
RILALPENEKVNAFRRKQENEFQCAFDRKVATLKRLVENSGKPTGKAYEYQMTGYSIESI
AIQQALLEICEILLGTGVIQMNQQELDHRIPIITGKNLRDGLAHDMSMYDVINESRANYV
CNAIYYGTLSLKLYDRKDWPKAVPFKEKEFIKITDKLHWFEMQRKLFEQLKDLEKFDFKC
NKIDESDILGCTRETKADFTTVHNNALLQALRHNMQSFVDHVDGIKFSRTFQRLINEISH
PSIPRKTPNQMSYPEKAQTLLNVTLEIEDFYTYRKITQKYNASFTYQAAYKRNPNVLNHL
EDLNLQPSTQMLLDSITSGNISAFRWLMKKLDPDSIRSCSPLKIALANGQLEISKSLVEI
VIPDVKDAEIAVLNHFNDILGQILPHVNEFSSLYKSAVARDNFAAIILMEASSCPCPIDK
DLLYYVAAYNRTSILEHFLQNPEWREHINDHTGNGQTLIDIFAQNGNFQAVKMISEYSTN
VVSAMKSAARRKHIGIVKFLLNLKPHVLPDMLTDLINCSIQTKNNTLLKYLLNRYTINAK
DRLDLSEHFLCAINCHNFDALELILKYDPLAAQSSKNHYNAYHFLVQALSTCTKADLNVH
SERILNLLKTYNADPIYKDKSGMTPLNRAVTFHNLELVRRLCQLGPSAVNEPDAIGRTPL
ISALIVGNLPIVQYLIQQGAPLEGLSTFRYPILHNVPPVTHFLDRNIECLQYAVRTLNLD
LELTDAFGRTLLHELCRADNVTFVAFLLEQCNANVYARDKNGETVLHCAIRCDSRAILGY
LLERVDRSDLLEKANGGGETALMLAFAIPGRMTMAYEMVKAGASKERLLQKIAGSCKEAL
QYMNK
Download sequence
Identical sequences A0A1S4EYW7
XP_001659178.2.48696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]