SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S5V051 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S5V051
Domain Number 1 Region: 19-90
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000432
Family Pseudo ankyrin repeat 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1S5V051
Sequence length 189
Comment (tr|A0A1S5V051|A0A1S5V051_MIMIV) DNA/RNA helicase {ECO:0000313|EMBL:AQN68015.1} OX=1956188 OS=Saudi moumouvirus. GN= OC=Viruses; dsDNA viruses, no RNA stage; Mimiviridae; Mimivirus.
Sequence
MEFDITLMENDNVEAIKKLDLKKINIPLYTLCAKYDSVKILEHIHKKNPNMKNNYFANSD
AMYIAINHGSTKVFSYIIDNGFYFSYQIKDIILDRHTKFPIQVIGKNKIMQIIENSVLII
GVDNVVNYKGEQISTYIKPEKIFEDEIHEDININVKIPQSISKPKYRLGINATPIRQTSL
KESLSYILD
Download sequence
Identical sequences A0A1S5V051 L7RBU3
gi|441432071|ref|YP_007354113.1| YP_007354113.1.9493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]