SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S5V0A1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S5V0A1
Domain Number 1 Region: 202-305
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000122
Family Pseudo ankyrin repeat 0.021
Further Details:      
 
Domain Number 2 Region: 115-190
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000262
Family Pseudo ankyrin repeat 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S5V0A1
Sequence length 322
Comment (tr|A0A1S5V0A1|A0A1S5V0A1_MIMIV) Ankyrin repeat protein {ECO:0000313|EMBL:AQN68066.1} OX=1956188 OS=Saudi moumouvirus. GN= OC=Viruses; dsDNA viruses, no RNA stage; Mimiviridae; Mimivirus.
Sequence
MNELFVKITNEQELHNGFQYSDGLNILDSNFNENCDDFYGSGGFYITSLKNINKYYYCGI
NLRIVELPLLDKNFKIVPVGDSWRVNMLIMKEKYSLYDKSTYDKFGLKMEDNDFIVDFAS
KNNNIKFFNDWTDHKLLLKYTINSIDDASILGNIDILNWWQESGLDLIYTSRAINYASAN
NQIRILNWWKCSNLKLLYTSEALDLASKNGHKETLDWWLKSGLTLKYTEKSMDWASMKNQ
YEVLDWWLNSGLTPRYSYEAMDYASWNGNVSVLNWWIKSGLELKYTKNYYFWYNNNDNKS
NTNILDWWRQSGLKIKFKHLQQ
Download sequence
Identical sequences A0A1S5V0A1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]