SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S5V1K6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S5V1K6
Domain Number 1 Region: 20-123
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 1.1e-23
Family FAD-dependent thiol oxidase 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S5V1K6
Sequence length 275
Comment (tr|A0A1S5V1K6|A0A1S5V1K6_MIMIV) Sulfhydryl oxidase {ECO:0000256|RuleBase:RU371123} OX=1956188 OS=Saudi moumouvirus. GN= OC=Viruses; dsDNA viruses, no RNA stage; Mimiviridae; Mimivirus.
Sequence
MGVNSKCAINHGDHRNNGLITKVWGGAGWTFCHSVTFGYPLKPTTDDKNNYKNFFISLGD
VLPCKYCRESYKKFITEGETALTTEVLENRESLTKWFYRVHNAVNQKLKVEYAVSYEDVV
EKYESFRAKCGKPKETSKGCVTPLDYKAFSFKKLYYSDAPIIPLFDVEKLINLAKIKDLV
PEYFTFYNLAKELNGDISKLKNQPCWSYRNQYCQKQIRYMRENGIASVDEEGIPTRDELK
LIVFMCSNLNKSELNTAIEKTLKVFGDHNNKLSFE
Download sequence
Identical sequences A0A1S5V1K6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]