SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S7QBF6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S7QBF6
Domain Number 1 Region: 5-171
Classification Level Classification E-value
Superfamily Heme iron utilization protein-like 2.22e-48
Family ChuX-like 0.0000000352
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S7QBF6
Sequence length 174
Comment (tr|A0A1S7QBF6|A0A1S7QBF6_9RHIZ) Uncharacterized protein {ECO:0000313|EMBL:CUX34289.1} KW=Complete proteome OX=1183431 OS=Agrobacterium genomosp. 6 str. NCPPB 925. GN=AGR6A_Cc20021 OC=Agrobacterium tumefaciens complex.
Sequence
MSIAAQKTDDDRQARAAAALAEKPDGIVEAIAARAEVTPAEILAILPEGAAVSAPADRFD
AIWNEMRGWGEVLMIVQTGDIVLEVPGHLPEGSESHGWFNIHGDSPIGGHIKKDNCAAIT
FVDRGFHGRRSCSVWFMNAAGGAMFKIFVRRDENKELLAGQLAKFETLRDGFRG
Download sequence
Identical sequences A0A1S7QBF6
WP_080827222.1.11911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]